Products for Research Use Only
RegisterLogin

OPG Human, HEK

CAT: 0793-32-6514-2Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-6514-2Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: HEK293 Cells.Sterile Filtered White lyophilized (freeze-dried) powder.Osteoprotegerin acts as decoy receptor for rankl and thereby neutralizes its function in osteoclastogenesis. OPG inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local rankl/opg ratio. Osteoprotegerin may also play a role in preventing arterial calcification. May act as decoy receptor for trail and protect against apoptosis. Trail binding blocks the inhibition of osteoclastogenesis.OPG Human Recombinant is a single, glycosylated polypeptide chain containing 393 amino acids (22-401a.a) and having a molecular mass of 45.0kDa (calculated) . OPG is fused to a 13 a.a FLAG- tag at N-terminal.
Product Name Alternative
TNFRSF11B, OPG, OCIF, Osteoclastogenesis inhibitory factor, Osteoprotegerin, TR1, MGC29565.
Purification
Greater than 90.0% as determined by SDS-PAGE.
Components
OPG filtered (0.4 μm) and lyophilized from 0.5mg/mL solution in PBS, pH7.5 and 5% (w/v) Trehalose.It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/mL and let the lyophilized pellet dissolve completely.
Storage Conditions
Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Amino Acids
PGDYKDDDDKPAGETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYC SPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAP CRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESV ERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEK TIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQ

Related Products

CatalogName
32-13742-10CD9 Human, HEK
32-13676-10MCP1 Human, HEK
32-13665-2Resistin Human, HEK
32-13656-10IL19 Human, HEK
32-13646-2FGF19 Human, HEK
32-13377-2RARRES2 Human, HEK
32-6889-2PON1 Human, HEK
32-6362-10FSTL1 Human, HEK
32-13800-10SIRPA Human, HEK
32-13800-2SIRPA Human, HEK

Alternative Products

CatalogName
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)
PT_41403-01Human Leptin (Leptin Human)
PT_40803-01Haptoglobin Human (Haptoglobin Human)

Popular Products