Products for Research Use Only
RegisterLogin

Recombinant Hepatitis B Surface Antigen preS2

CAT: 0793-32-5531-50Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-5531-50Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : E.coli. The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique. Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2.
Purification
HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining) .
Components
HBsAg protein was lyophilized from 0.2μm filtered (1mg/mL) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Storage Conditions
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at
Amino Acids
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.

Related Products

CatalogName
32-5530-50Recombinant Hepatitis B Surface Antigen preS1
32-5519-100Recombinant Hepatitis B Surface Antigen Adw subtype
32-5515-50Recombinant Hepatitis B Surface Antigen ayw subtype
32-5514-50Recombinant Hepatitis B Surface Antigen ayw subtype, Saccharomyces
32-5518-100Recombinant Hepatitis B Surface Antigen adr subtype, CHO
32-5503-25Recombinant Hepatitis B Virus e-Antigen
32-5431-0.5Recombinant Hepatitis C Virus Mosaic Antigen-B
32-5430-0.5Recombinant Hepatitis C Virus Mosaic Antigen-A
32-5460-0.5Recombinant Hepatitis C Virus NS4 a+b
32-5502-20Recombinant Human Hepatitis B Virus x Interacting Protein

Alternative Products

CatalogName
H1910-35-01Hepatitis B Surface Antigen PreS2 (HBV PreS2)
RC783-13Hepatitis B Surface Antigen preS2, rHBsAg-preS2
PT_73836-01Hepatitis B Surface Antigen, preS2 Recombinant (HBsAg preS2)
7-07506Recombinant Hepatitis B Surface Antigen preS2
rAP-5204Hepatitis B Surface Antigen, preS2 Recombinant
H1909-32G-01Hepatitis B Surface Antigen preS2, Recombinant (rHBsAg preS2) discontinued
MBS434108-01HBsAg preS2, Hepatitis B Surface Antigen (55 aa)
H1915-98GHepatitis B Surface Antigen PreS2 (HBV PreS2) discontinued. see H1910-35
208968Hepatitis B Surface Antigen, preS2, Recombinant, (HBsAg, HBV) discontinued
GTR19035426-01Recombinant HBV Surface Antigen-preS2

Popular Products