Products for Research Use Only
RegisterLogin

Recombinant Streptavidin

CAT: 0793-32-4989-20Size: 20 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-4989-20Size:20 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa. Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14) . The complexes are also extremely stable over a wide range of temperature and pH.
Purification
Greater than 98.0% as determined by SDS-PAGE and HPLC.
Components
Lyophilized in 10mM potassium phosphate buffer pH 6.5.
Storage Conditions
Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
Applications Notes
It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Amino Acids
MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

Related Products

CatalogName
32-4988-10Streptavidin
30-2932PE-100Streptavidin PE Conjugated
30-2932F-0.1FITC Conjugated Streptavidin
30-2932AC-100Streptavidin APC Conjugated
32-5505-0.5Recombinant Hantavirus
32-13235-100Fribronectin Recombinant
32-13235-20Fribronectin Recombinant
32-13042-5Avidin Recombinant
32-13042-25Avidin Recombinant
32-4495-10Recombinant Prelamin-A

Alternative Products

CatalogName
PT_42149-01Streptavidin Recombinant (Streptavidin)
22060700-3Streptavidin (Recombinant)
P5084-20mgRecombinant Streptavidin
B2013358Streptavidin Recombinant
PT_42148-01Streptavidin-NC Recombinant (Streptavidin-NC)
PT_72199-01Streptavidin Recombinant, His Tag (Streptavidin, His)
PROTP22629-1Streptavidin, Streptavidin Recombinant Protein, His Tag
7-06560Recombinant Streptavidin-NC
P5087-1mgRecombinant Monomeric Streptavidin
NCP0373-01Streptavidin Recombinant Protein

Popular Products