Products for Research Use Only
RegisterLogin

Recombinant Rat Tropic 1808

CAT: 0793-32-4721-50Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-4721-50Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa.The Tpc1808 is purified by proprietary chromatographic techniques. Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
Product Name Alternative
Tropic 1808||Tpc1808.
Purification
Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Storage Conditions
Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles.
Amino Acids
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS.

Related Products

CatalogName
32-4779-10Recombinant Rat Secretagogin
32-9513-500Recombinant Rat IgG2A Fc
32-4621-5Recombinant Rat Calbindin-1
32-8567-10Recombinant Rat VEGF-A/VEGF164
32-9513-50Recombinant Rat IgG2A Fc
32-8567-50Recombinant Rat VEGF-A/VEGF164
32-9864-50Recombinant Rat Albumin (C-His)
32-9379-50Recombinant Rat SCF (C-6His)
32-7424-50Recombinant Rat M-CSF/CSF1
32-4712-20Recombinant Rat Receptor Associated Protein

Alternative Products

CatalogName
7-06711Recombinant Rat Tropic 1808
rAP-4409Tropic 1808 Rat Recombinant
NBP2-35302-1mgRecombinant Rat Tropic 1808 Protein
PROTQ9R0C2-01Tpc1808 Tropic 1808 Rat Recombinant Protein
PT_42305-01Tropic 1808 Rat Recombinant (Tpc1808 Rat)
RP-997Recombinant (E.Coli, his tag) Rat Tropic 1808
abx260456-01Tropic 1808 Protein
H6003-03BHIV-1 env gp41, Strain YU2 (M Tropic), Recombinant (Human Immunodeficiency Virus-1)
MBS636028-01HIV-1 env gp120, Strain YU2 (M Tropic), Recombinant (Human Immunodeficiency Virus-1)
374516-01NUP210, Recombinant, Human, aa1529-1808, His-Tag (Nuclear Pore Membrane Glycoprotein 210)

Popular Products