RegisterLogin

Pramlintide Protein

CAT: 0793-32-2062-5Size: 5 mgDry Ice: NoHazardous: No
CAT#:0793-32-2062-5Size:5 mg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2. Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.
Purification
Greater than 98.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
The protein was lyophilized with no additives.
Storage Conditions
Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
Amino Acids
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.

Related Products

CatalogName
32-4792-25Recombinant Protein Export Protein SecB
32-10248-50Recombinant Human Protein transport protein Sec16B
32-10248-500Recombinant Human Protein transport protein Sec16B
32-2018-5EDN3 Protein
32-6814-250KLK3 Protein
32-13734-5C5a Protein
32-13734-1C5a Protein
32-13019-2AFP Protein
32-2047-1Lanreotide Protein
32-2091-10Trp Protein

Alternative Products

CatalogName
OPPA01546-1MGPramlintide Protein
QP13132-5mgRecombinant other Pramlintide Protein, Untagged, E.coli-5mg
QP13132-1mgRecombinant other Pramlintide Protein, Untagged, E.coli-1mg
QP13132-25mgRecombinant other Pramlintide Protein, Untagged, E.coli-25mg
PT_41826-01Pramlintide (Pramlintide)
T38998Pramlintide
MBS3847350-01Pramlintide acetate
abx657041-01Pramlintide (BSA)
HY-P0058APramlintide (TFA)
HY-P0058B-01Pramlintide (acetate)

Popular Products