Pramlintide Protein
For Laboratory Research Only. Not for Clinical or Personal Use.
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Pramlintide Protein
Gene Aliases :
PramlintideTarget :
Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.Type :
ProteinSequence :
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.Assay Protocol :
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat :
Lyophilized.// Sterile Filtered White (freeze-dried) powder with no additives.Reconstitution :
Reconstitution: //It is recommended to reconstitute the lyophilized Pramlintide in sterile 18M Omega-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid. Storage: //Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Pramlintide should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.Storage: //Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Pramlintide should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.Molecular Weight :
4 kDaNotes :
Formerly GWB-7D1DF8NCBI Gene Symbol :
PRAMLINTIDEGene Name URL :
Pramlintide

