Products for Research Use Only
RegisterLogin

VEGI Recombinant Protein

CAT: 0793-32-1847-20Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1847-20Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. TNFSF15 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 20.5kDa. The TNFSF15 is purified by proprietary chromatographic techniques. TNFSF15 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of TNFSF15 is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. TNFSF15 is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.
Product Name Alternative
Tumor necrosis factor ligand superfamily member 15||TNFSF-15||TNFSF15||TNF ligand-related molecule 1||VEGI||TL-1||TL1||TL1A||VEGI192A||VEGI-192||MGC129934||MGC129935.
Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
The TNFSF15 was lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.
Storage Conditions
TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGI should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0ƒâ€”104 IU/mg.
Amino Acids
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.

Related Products

CatalogName
32-1848-20VEGI His Recombinant Protein
12-1256-20Anti-TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) Recombinant Rabbit Monoclonal Antibody (Clone:VEGI/2052R)
12-1256-100Anti-TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) Recombinant Rabbit Monoclonal Antibody (Clone:VEGI/2052R)
36-3672-100Anti-TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) Monoclonal Antibody (Clone: VEGI/1283)
36-3672-20Anti-TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) Monoclonal Antibody (Clone: VEGI/1283)
32-1824-10VEGF Recombinant Protein
12-1255-100Anti-TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) Recombinant Mouse Monoclonal Antibody (Clone:rVEGI/1283)
12-1255-20Anti-TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) Recombinant Mouse Monoclonal Antibody (Clone:rVEGI/1283)
32-1131-20MEG VEGF Recombinant Protein
32-1828-10VEGF Yeast Recombinant Protein

Alternative Products

CatalogName
CRP3070-01Recombinant Mouse VEGI Protein
CD00686-01Recombinant Human VEGI 192 protein
PROTO95150-1VEGI Human, Vascular Endothelial Growth InhibitorHuman Recombinant Protein, His Tag
OPPA01498-5UGVEGI Protein
GTR18984891-01Human VEGI Protein
4966-1000VEGI/TL1 human recombinant
GTR18984880-01Human VEGI (His) Protein
V3637-20UGRecombinant TL1A Antibody / TNFSF15 / VEGI
V3636IHC-7MLRecombinant TNFSF15 Antibody / TL1A / VEGI
GTR18573722Recombinant VEGI Antibody / TL1A / TNFSF15

Popular Products