Products for Research Use Only
RegisterLogin

Human VEGI Protein

CAT: 0013-GTR18984891-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18984891-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of human VEGI protein
Product Name Alternative
Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935.
Source
Escherichia Coli
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0x104 IU/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGI should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
The TNFSF15 was lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.
AA Sequence
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Related Products

CatalogName
GTR18984880-01Human VEGI (His) Protein
GTR18900865-01VEGI peptide
GTR18194729VEGI Polyclonal Antibody
GTR18104687-01VEGI Rabbit Polyclonal Antibody
GTR18574239TL1A Antibody / VEGI / TNFSF15
GTR18042046-01VEGI (F141) polyclonal antibody
GTR18225914TNFSF15/TL1A/VEGI Antibody
GTR18082411-01TL1A Antibody / VEGI / TNFSF15
GTR18225045TNFSF15/TL1A/VEGI Antibody
GTR18051021VEGI rabbit pAb Antibody

Alternative Products

CatalogName
CD00686-01Recombinant Human VEGI 192 protein
PROTO95150-1VEGI Human, Vascular Endothelial Growth InhibitorHuman Recombinant Protein, His Tag
OPPA01498-5UGVEGI Protein
CYT-517-01VEGI Human
32-1847-20VEGI Recombinant Protein
OM301345-01VEGI Human, His
CRP3070-01Recombinant Mouse VEGI Protein
32-1848-20VEGI His Recombinant Protein
4966-1000VEGI/TL1 human recombinant
E109776Human VEGI ELISA Kit

Popular Products