Products for Research Use Only

EBI3 Recombinant Protein

CAT: 0793-32-1127-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1127-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques. EBI3 has an induced expression in B lymphocytes in reaction to Epstein-Barr virus infection. EBI3 encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form iIL-27. EBI3 drives rapid clonal expansion of naive cd4 (+) t-cells. EBI3 strongly synergizes with IL-12 to activate IFN-gamma production of naive cd4 (+) t-cells. EBI3 mediates its biologic effects through the cytokine receptor wsx-1/tccr.
Product Name Alternative
Interleukin-27 subunit beta||IL-27 subunit beta||IL-27B||Epstein-Barr virus-induced gene 3 protein||EBV-induced gene 3 protein||EBI3||IL27B.
Purification
Greater than 90% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Storage Conditions
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
Amino Acids
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.