BNP Protein

CAT: 0793-32-1100-25Size: 25 mgDry Ice: NoHazardous: No
CAT#:0793-32-1100-25Size:25 mg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4. Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Product Name Alternative
NPPB||Natriuretic Peptide Precursor B||BNP||B-type Natriuretic Peptide.
Purification
Greater than 95.0% as determined by RP-HPLC.
Components
The protein was lyophilized without additives.
Storage Conditions
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Amino Acids
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Related Products

CatalogName
32-1098-10BNP Recombinant Protein
32-1099-10BNP His Recombinant Protein
32-6315-10BNP (27-102) Human
32-6315-2BNP (27-102) Human
32-8696-10Recombinant Human Brain Natriuretic Peptide/BNP (N-6His-Flag)
32-8696-50Recombinant Human Brain Natriuretic Peptide/BNP (N-6His-Flag)
32-9222-50Recombinant Human Brain Natriuretic Peptide/BNP (His27-His134, N-6His)
32-9222-500Recombinant Human Brain Natriuretic Peptide/BNP (His27-His134, N-6His)
32-4792-25Recombinant Protein Export Protein SecB
32-10248-50Recombinant Human Protein transport protein Sec16B

Alternative Products

CatalogName
abx069907Protein A Protein
RA101Protein G Protein
NBP1-97288Protein A Native Protein
abx262179-01Protein A / G Protein
NBP2-34965Recombinant Protein A Protein
abx061407PLDH Protein Protein
abx262993-01Protein L Protein
abx262074-01Centromere Protein-A Protein
OPPA01758-1MGProtein A/G Protein

Popular Products