Products for Research Use Only
RegisterLogin

BNP Recombinant Protein

CAT: 0793-32-1098-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1098-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques. Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Product Name Alternative
NPPB||Natriuretic Peptide Precursor B||BNP||B-type Natriuretic Peptide.
Purification
Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Storage Conditions
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Amino Acids
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.

Related Products

CatalogName
32-1099-10BNP His Recombinant Protein
32-1100-25BNP Protein
32-6315-2BNP (27-102) Human
32-6315-10BNP (27-102) Human
32-8696-10Recombinant Human Brain Natriuretic Peptide/BNP (N-6His-Flag)
32-8696-50Recombinant Human Brain Natriuretic Peptide/BNP (N-6His-Flag)
32-9222-500Recombinant Human Brain Natriuretic Peptide/BNP (His27-His134, N-6His)
32-9222-50Recombinant Human Brain Natriuretic Peptide/BNP (His27-His134, N-6His)
32-4513-10Recombinant Protein L
32-3516-20CFL2 Recombinant Protein

Alternative Products

CatalogName
NBP2-34965Recombinant Protein A Protein
PROTB3GGB2-100ugS. aureus Recombinant Protein A Recombinant Protein
96-361Glyco Recombinant Protein A33 Recombinant Protein
TP780003Enterokinase Recombinant Protein (Enterokinase) Recombinant Protein
TMPY-00125Recombinant Protein A
OPCD05912-50UGON Recombinant Protein
OPCD00940-200UGWAS Recombinant Protein
22060644-1Protein A (Recombinant)

Popular Products