Products for Research Use Only

REG4 Mouse (His)

CAT: 0804-HY-P79158Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P79158Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
REG4 protein, a calcium-independent lectin, binds specifically to mannose and maintains carbohydrate recognition in acidic environments. It is implicated in the inflammatory and metaplastic responses of the gastrointestinal epithelium. REG4 Protein, Mouse (His) is the recombinant mouse-derived REG4 protein, expressed by E. coli , with C-10*His tag.
Product Name Alternative
REG4 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Smiles
DILRPSCAPGWFYYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNQKEASVISKYITGYQRNLPVWIGLHDPQKKQLWQWTDGSTNLYRRWNPRTKSEARHCAEMNPKDKFLTWNKNGCANRQHFLCKYKT
Molecular Formula
67709 (Gene_ID) NP_080604.2/Q9D8G5 (D23-T157) (Accession)
Molecular Weight
Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation .
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins