Pleiotrophin, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Pleiotrophin, Human
Description :
Pleiotrophin is a secreted growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors to influence a variety of cellular processes. It binds to chondroitin sulfate (CS) groups, regulates proliferation, survival and differentiation, and inhibits long-term synaptic potentiation of neurons. Pleiotrophin Protein, Human is the recombinant human-derived Pleiotrophin protein, expressed by E. coli , with tag free. The total length of Pleiotrophin Protein, Human is 136 a.a., with molecular weight of ~15.3 kDa.Product Name Alternative :
Pleiotrophin Protein, Human, Human, E. coliUNSPSC :
12352202Purity :
96.00Smiles :
GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLDMolecular Formula :
5764 (Gene_ID) P21246 (G33-D168) (Accession)Molecular Weight :
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

