Pleiotrophin, Human

• Description :

  Pleiotrophin is a secreted growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors to influence a variety of cellular processes. It binds to chondroitin sulfate (CS) groups, regulates proliferation, survival and differentiation, and inhibits long-term synaptic potentiation of neurons. Pleiotrophin Protein, Human is the recombinant human-derived Pleiotrophin protein, expressed by E. coli , with tag free. The total length of Pleiotrophin Protein, Human is 136 a.a., with molecular weight of ~15.3 kDa.

• Product Name Alternative :

  Pleiotrophin Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Purity :

  96.00

• Smiles :

  GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

• Molecular Formula :

  5764 (Gene_ID) P21246 (G33-D168) (Accession)

• Molecular Weight :

  Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins