Products for Research Use Only

Pleiotrophin, Human

CAT: 0804-HY-P71907-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71907-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Pleiotrophin is a secreted growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors to influence a variety of cellular processes. It binds to chondroitin sulfate (CS) groups, regulates proliferation, survival and differentiation, and inhibits long-term synaptic potentiation of neurons. Pleiotrophin Protein, Human is the recombinant human-derived Pleiotrophin protein, expressed by E. coli , with tag free. The total length of Pleiotrophin Protein, Human is 136 a.a., with molecular weight of ~15.3 kDa.
Product Name Alternative
Pleiotrophin Protein, Human, Human, E. coli
UNSPSC
12352202
Purity
96.00
Smiles
GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Molecular Formula
5764 (Gene_ID) P21246 (G33-D168) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Popular Products