MAP1LC3B, Human (His)

CAT:
804-HY-P70909A-01
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: Yes
MAP1LC3B, Human (His) - image 1

MAP1LC3B, Human (His)

  • Description :

    MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human (His) is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with C-His.
  • Product Name Alternative :

    MAP1LC3B Protein, Human (His), Human, E. coli
  • UNSPSC :

    12352202
  • Smiles :

    MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
  • Molecular Formula :

    81631 (Gene_ID) Q9GZQ8 (M1-V125) (Accession)
  • Molecular Weight :

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Dry ice.
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide