Products for Research Use Only

MAP1LC3B, Human (His)

CAT: 0804-HY-P70909A-01Size: 50 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70909A-01Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human (His) is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with C-His.
Product Name Alternative
MAP1LC3B Protein, Human (His), Human, E. coli
UNSPSC
12352202
Smiles
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Molecular Formula
81631 (Gene_ID) Q9GZQ8 (M1-V125) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Popular Products