Products for Research Use Only

Kras4B, Human (G13D, His)

CAT: 0804-HY-P704177-01Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704177-01Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The Kras4B protein interacts specifically with GPR31, dependent on farnesylation. This binding suggests a regulatory role for Kras4B in association with GPR31, emphasizing the importance of the farnesylation process. Comprehensive exploration into the molecular details of this interaction is crucial to understand the precise mechanisms and functional implications in cellular processes or signaling pathways. Kras4B Protein, Human (G13D, His) is the recombinant human-derived KRAS protein, expressed by E. coli, with N-His labeled tag.
Product Name Alternative
Kras4B Protein, Human (G13D, His), Human, E. coli
UNSPSC
12352202
Purity
95.0
Smiles
TEYKLVVVGAGDVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
Molecular Formula
3845 (Gene_ID) P01116-2 (T2-C185) (Accession)
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Popular Products