Recombinant Human Agrin (AGRN), partial

CAT:
617-RPC31215-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Agrin (AGRN), partial - image 1

Recombinant Human Agrin (AGRN), partial

  • Description :

    Recombinant Human Agrin (AGRN), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Agrin (AGRN) . Accession Number: O00468; AGRN. Expression Region: 1868-2065aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 27.3kda. Target Synonyms: C90; C22 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description :

    Recombinant Human Agrin (AGRN), partial is a purified Recombinant Protein.
  • Accession Number :

    O00468; AGRN
  • Expression Region :

    1868-2065aa
  • Host :

    E. coli
  • Target :

    Agrin (AGRN)
  • Conjugation :

    Unconjugated
  • Tag :

    N-Terminal 10xHis-Tagged
  • Field of Research :

    Others
  • Endotoxin :

    Not Tested
  • Purity :

    >85% by SDS-PAGE
  • Activity :

    Not Tested
  • Length :

    Partial
  • Reconstitution :

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight :

    27.3kDa
  • Shipping Conditions :

    Ice packs
  • Storage Conditions :

    -20°C. Avoid repeated freeze/thaw cycles.
  • Target Alternative Name :

    C90; C22
  • Species :

    Human (Homo sapiens)
  • Protein Name :

    Recombinant Protein
  • AA Sequence :

    VDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPC

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide