Recombinant Human Agrin (AGRN), partial

• Description :

  Recombinant Human Agrin (AGRN), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Agrin (AGRN) . Accession Number: O00468; AGRN. Expression Region: 1868-2065aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 27.3kda. Target Synonyms: C90; C22 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description :

  Recombinant Human Agrin (AGRN), partial is a purified Recombinant Protein.

• Accession Number :

  O00468; AGRN

• Expression Region :

  1868-2065aa

• Host :

  E. coli

• Target :

  Agrin (AGRN)

• Conjugation :

  Unconjugated

• Tag :

  N-Terminal 10xHis-Tagged

• Field of Research :

  Others

• Endotoxin :

  Not Tested

• Purity :

  >85% by SDS-PAGE

• Activity :

  Not Tested

• Length :

  Partial

• Reconstitution :

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight :

  27.3kDa

• Shipping Conditions :

  Ice packs

• Storage Conditions :

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name :

  C90; C22

• Species :

  Human (Homo sapiens)

• Protein Name :

  Recombinant Protein

• AA Sequence :

  VDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPC