Recombinant Hypoderma lineatum Hypodermin-A
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Hypoderma lineatum Hypodermin-A
Description :
Recombinant Hypoderma lineatum Hypodermin-A is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hypoderma lineatum (Early cattle grub) (Common cattle grub) . Target Name: Hypodermin-A. Accession Number: P35587. Expression Region: 31-256aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 28.8kda. Target Synonyms: HA Restrictions: For Research Use Only. Not for use in diagnostic procedures.Short Description :
Recombinant Hypoderma lineatum Hypodermin-A is a purified Recombinant Protein.Accession Number :
P35587Expression Region :
31-256aaHost :
E. coliTarget :
Hypodermin-AConjugation :
UnconjugatedTag :
N-Terminal 6xHis-TaggedField of Research :
OthersEndotoxin :
Not TestedPurity :
>85% by SDS-PAGEActivity :
Not TestedLength :
Full Length of Mature ProteinReconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
28.8kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
HASpecies :
Hypoderma lineatum (Early cattle grub) (Common cattle grub)Protein Name :
Recombinant ProteinAA Sequence :
IVGGVESKIEDFPWQISLQRDGRHYCGGSIYSKNVIITAAHCLRNVVAEELRVRVGSSYWEHGGSLRNISKFQIHESYVEPTKEYDVALLKLDSDLSFNSTIKAIELTNEIPPEYADAIVSGWGETLVPPPGIPDQLRSVDVKIIHREKCASRNFGYGSNIKASMICAYAIGKDSCQGDSGGPLVVNNLLVGVVSWGIDCARPSYPGVYVDVSHVRSWIVSNAESI

