Recombinant Human Haptoglobin (HP)

• Description:

  Recombinant Human Haptoglobin (HP) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Haptoglobin (HP) . Accession Number: P00738; HP. Expression Region: 19-406aa. Tag Info: N-terminal 6xHis-B2M-tagged. Theoretical MW: 57.3kda. Target Synonyms: Zonulin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Human Haptoglobin (HP) is a purified Recombinant Protein.

• Accession Number:

  P00738; HP

• Expression Region:

  19-406aa

• Host:

  E. coli

• Target:

  Haptoglobin (HP)

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 6xHis-B2M-Tagged

• Field of Research:

  Cardiovascular

• Endotoxin:

  Not Tested

• Purity:

  >85% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length of Mature Protein

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  57.3kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Zonulin

• Species:

  Human (Homo sapiens)

• Protein Name:

  Recombinant Protein

• AA Sequence:

  VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN