Products for Research Use Only
RegisterLogin

Recombinant Human AP-2 complex subunit sigma (AP2S1)

CAT: 0617-RPC29801-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0617-RPC29801-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant Human AP-2 complex subunit sigma (AP2S1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: AP-2 complex subunit sigma (AP2S1) . Accession Number: P53680; AP2S1. Expression Region: 1-142aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 23.9kda. Target Synonyms: Adaptor protein complex AP-2 subunit sigma; Adaptor-related protein complex 2 subunit sigma; Clathrin assembly protein 2 sigma small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description
Recombinant Human AP-2 complex subunit sigma (AP2S1) is a purified Recombinant Protein.
Accession Number
P53680; AP2S1
Expression Region
1-142aa
Host
E. coli
Target
AP-2 complex subunit sigma (AP2S1)
Conjugation
Unconjugated
Tag
C-Terminal 6xHis-Tagged
Field of Research
Signal Transduction
Endotoxin
Not Tested
Purity
>90% by SDS-PAGE
Activity
Not Tested
Length
Full Length
Reconstitution
Refer to the datasheet/CoA included in the product pouch.
Molecular Weight
23.9kDa
Shipping Conditions
Ice packs
Storage Conditions
-20°C. Avoid repeated freeze/thaw cycles.
Target Alternative Name
Adaptor protein complex AP-2 subunit sigma; Adaptor-related protein complex 2 subunit sigma; Clathrin assembly protein 2 sigma small chain; Clathrin coat assembly protein AP17; Clathrin coat-associated protein AP17; HA2 17 kDa subunit; Plasma membrane adaptor AP-2 17 kDa protein; Sigma2-adaptin
Species
Human (Homo sapiens)
Protein Name
Recombinant Protein
AA Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Related Products

CatalogName
RPU58249-01Recombinant Human Adaptor Related Protein Complex 2 Sigma 1 (AP2s1)
RPC28587-01Recombinant Human AP-2 complex subunit mu (AP2M1)
RPU58244-01Recombinant Human Adaptor Related Protein Complex 1 Sigma 2 (AP1s2)
RPU58255-01Recombinant Human Adaptor Related Protein Complex 3 Sigma 2 (AP3s2)
RPC25820-01Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial
RPC26133-01Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial
RPC25428-01Recombinant Human COP9 signalosome complex subunit 2 (COPS2)
RPU58257-01Recombinant Human Adaptor Related Protein Complex 4 Sigma 1 (AP4s1)
RPU58243-01Recombinant Human Adaptor Related Protein Complex 1 Sigma 1 (AP1s1)
RPU58254-01Recombinant Human Adaptor Related Protein Complex 3 Sigma 1 (AP3s1)

Alternative Products

CatalogName
abx125522-01AP-2 Complex Subunit Sigma (AP2S1) Antibody
A07176Anti-AP-2 complex subunit sigma AP2S1 Antibody
MBS960839-01Recombinant Mouse AP-2 complex subunit sigma (Ap2s1)
abx659400-01Human AP-2 Complex Subunit Sigma (AP2S1) Protein
CSB-EP001873HU-01Recombinant Human AP-2 complex subunit sigma (AP2S1)
MBS952874-01Recombinant Rat AP-2 complex subunit sigma (Ap2s1)
MBS1291374-01Recombinant Bovine AP-2 complex subunit sigma (AP2S1)
abx117415AP-2 Complex Subunit Sigma (AP2S1) Antibody Pair
MBS7225096-01Chicken AP-2 complex subunit sigma (AP2S1) ELISA Kit
MBS7241583-01Human AP 2 complex subunit sigma (AP2S1) ELISA Kit

Popular Products