TGF b 1 Human, GST

CAT: 1071-OM301493-01Size: 2 µgDry Ice: NoHazardous: No

1 / 1

CAT#:1071-OM301493-01Size:2 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

The Recombinant Human TGF-b1 (aa 309-390) is purified by standard chromatographic techniques and shows a 35kDa band on SDS-PAGE (including GST tag) .

Swiss Prot

P01137

Source

Escherichia Coli.

Buffer

The protein solution (500 µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced) .

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.

Sequence Similarities

KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRK

Related Products

Catalog	Name
P83251	PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
9230-50	Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
PT_74124-01	Fibronectin Human (Fibronectin Human)
PT_42353-01	Uromodulin Human (UMOD Human)
PT_42253-01	Thyroglobulin Human (Thyroglobulin Human)
PT_41668-01	Oxytocin Human (OT Human)
PT_41579-01	Myoglobin Human (Myoglobin Human)
PT_40676-01	Ghrelin Human (GHRL Human)
HTH100	Human-to-Human Blocking Reagent
OOPA00091-5UG	MPO Human - Human Myeloperoxidase