Products for Research Use Only
RegisterLogin

PRL R Human

CAT: 1071-OM301423-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM301423-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa.
Swiss Prot
P16471
Source
Escherichia Coli.
Buffer
The Prolactin Receptor was lyophilized from a concentrated (0.4mg/mL) solution with 045mM NaHCO3.
Storage Conditions
Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA) .
Sequence Similarities
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH

Related Products

CatalogName
OM301417-01PRL R Rat
OM301421-01PRL R Rabbit
OM301443-01PRL R Rainbow Trout
OM297006-01BAFF R Human
OM625873Goose Prolactin (PRL) ELISA Kit
OM642692Goat Prolactin (PRL) ELISA Kit
OM643774-01Recombinant Human R-Spondin-1
OM618210Bovine tenascin-R (TN-R) ELISA Kit
P0441Human, Rat, Mouse IFN-r antibody
OM770018Recombinant R-spondin-1 (RSPO1) (Human)

Alternative Products

CatalogName
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)
PT_41403-01Human Leptin (Leptin Human)
PT_40803-01Haptoglobin Human (Haptoglobin Human)

Popular Products