BAFF R Human

• Description:

  B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.

• Swiss Prot:

  Q96RJ3

• Source:

  Escherichia Coli.

• Buffer:

  Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 8.0, 500mM NaCl.

• Storage Conditions:

  Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG