BAFF R Human

CAT: 1071-OM297006-01Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:1071-OM297006-01Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.

Swiss Prot

Q96RJ3

Source

Escherichia Coli.

Buffer

Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 8.0, 500mM NaCl.

Storage Conditions

Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG

Related Products

Catalog	Name
OM297012-01	BAFF Human
OM297010-01	BAFF Human, His
OM297008-01	BAFF Human, Plant
OM301423-01	PRL R Human
OM643774-01	Recombinant Human R-Spondin-1
OM618210	Bovine tenascin-R (TN-R) ELISA Kit
P0441	Human, Rat, Mouse IFN-r antibody
OM770018	Recombinant R-spondin-1 (RSPO1) (Human)
OM301421-01	PRL R Rabbit
OM636853-01	Tenascin-R Antibody

Alternative Products

Catalog	Name
E34M050H	BAFF, Human
MBS555850-01	BAFF Human
MBS691816-01	Human BAFF
PT_74887-01	BAFF (BLyS) Human Recombinant, Plant (BAFF Human, Plant)
359855-01	BAFF Receptor, Recombinant, Human (BAFF-R) discontinued
MBS9719430-01	Human BAFF Protein
MBS7611695-01	Recombinant Human BAFF
MBS550659-01	Anti-Human BAFF
32834-05111	Human BAFF Antibody
PRP1035-01	Human BAFF Protein

BAFF R Human

Related Products

Alternative Products

Popular Products