Products for Research Use Only

SPP1 Human, HEK

CAT: 1071-OM301353-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM301353-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The actual molecular mass may be approximately 60-65kDa in SDS-PAGE under reducing conditions due to glycosylation) .
Swiss Prot
P10451
Source
HEK293 cells.
Buffer
Osteopontin was lyophilized from a 0.2µM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.
Sequence Similarities
IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETL