PLA2G7 Human, HEK

• Description:

  Recombinant Human PLA2G7 produced in HEK293 cells is a polypeptide chain (22-441 a.a), fused to an 8 amino acid His-tag at C-terminus, containing a total of 428 amino acids.

• Swiss Prot:

  Q13093

• Source:

  HEK293 cells.

• Buffer:

  The PLA2G7 is supplied as a 0.2µm filtered solution in 20mM HAc-NaCl, 150mM NaCl and 10% Glycerol, pH 4.5.

• Storage Conditions:

  Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.

• Sequence Similarities:

  FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPS