Products for Research Use Only
RegisterLogin

OSM Human, 209 a.a

CAT: 1071-OM301295-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM301295-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa.
Swiss Prot
P13725
Source
Escherichia Coli.
Buffer
Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1 mg/mL) solution containing 1x PBS pH-7.4.
Storage Conditions
Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPG

Related Products

CatalogName
OM301293-01OSM Human
OM643791-01Recombinant Human OSM
OM301301-01OSM Human, His
OM301279-01OSM Human, 195 a.a
OM301287-01OSM Human, HEK
OM636852-01OSM Antibody
OM301285-01OSM Rat
OM301267-01OSM Mouse
OM302864-01IF Human
OM305547-01POP7 Human

Alternative Products

CatalogName
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)
PT_41403-01Human Leptin (Leptin Human)
PT_40803-01Haptoglobin Human (Haptoglobin Human)

Popular Products