GHBP Human

CAT:
1071-OM300955-01
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GHBP Human - image 1

GHBP Human

  • Description :

    Growth Hormone Binding Protein Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 28107.01 Dalton.
  • Swiss Prot :

    P10912
  • Source :

    Escherichia Coli.
  • Buffer :

    GHBP was lyophilized from a concentrated (1 mg/mL) solution with 045mM NaHCO3.
  • Storage Conditions :

    Lyophilized Growth Hormone Binding Protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP should be stored at 4°C between 2-7 days and for future use below -18°C.
  • Sequence Similarities :

    AFSGSEATAAILSRAPWSLQSVNPGLKTNS SKEPKFTKCRSPERETFSCHWTDEVHHGTK

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide