GHBP Human

• Description:

  Growth Hormone Binding Protein Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 28107.01 Dalton.

• Swiss Prot:

  P10912

• Source:

  Escherichia Coli.

• Buffer:

  GHBP was lyophilized from a concentrated (1 mg/mL) solution with 045mM NaHCO3.

• Storage Conditions:

  Lyophilized Growth Hormone Binding Protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  AFSGSEATAAILSRAPWSLQSVNPGLKTNS SKEPKFTKCRSPERETFSCHWTDEVHHGTK