Products for Research Use Only
RegisterLogin

TNFR Human, His

CAT: 1071-OM297134-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM297134-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques.
Swiss Prot
P19438
Source
Escherichia Coli.
Buffer
TNFR His Tag protein is supplied in 1xPBS, 50% glycerol.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks.
Sequence Similarities
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQ

Related Products

CatalogName
OM297136-01TNFR Human
OM297130-01TNFR Human, Sf9
OM297138-01TNFR (22-211) Human
OM297132-01TNFR Mouse
OM297126-01TNFR2 Human, His
OM297176-01TNF a Human, His
OM297148-01TNF b Human, His
OM297154-01TNF a Rat, His
OM296872-01GDF15 Human, His
OM296830-01Acrp30 Human, His

Alternative Products

CatalogName
PT-A05569-01TNFR Human, Sf9
PT-A05568-01TNFR Human, His
GTR18984577-01Human TNFR Protein
PT-A05566-01TNFR (22-211) Human
GTR18984576-01Human TNFR (His) Protein
GTR18984575-01Human TNFR (Sf9) Protein
HC67831Human GITR /TNFR-SF18-Fc
UA040028-01TNFR-1/CD120a Protein, Human
H1900Soluble TNFR?) Human ELISA Kit
GTR18984574-01Human TNFR (22-211) Protein

Popular Products