TNFR2 Human, His

• Description:

  TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

• Swiss Prot:

  P20333

• Source:

  Escherichia Coli.

• Buffer:

  TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.

• Storage Conditions:

  Store at 4°C if entire vial will be used within 2-4 weeks.

• Sequence Similarities:

  LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWV