Products for Research Use Only

IL17E Mouse

CAT: 1071-OM296460-02Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM296460-02Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.
Swiss Prot
Q8VHH8
Source
Escherichia Coli.
Buffer
IL17E was lyophilized from a concentrated (1 mg/mL) solution containing no additives.
Storage Conditions
Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS

Popular Products