SCF, Mouse

CAT:
804-HY-P70528-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SCF, Mouse - image 1

SCF, Mouse

  • Description :

    SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis.Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules.SCF Protein, Mouse is the recombinant mouse-derived SCF protein, expressed by E.coli , with tag free.
  • Product Name Alternative :

    SCF Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/scf-protein-mouse.html
  • Purity :

    98.0
  • Smiles :

    KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
  • Molecular Formula :

    17311 (Gene_ID) P20826 (K26-A189) (Accession)
  • Molecular Weight :

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide