SCF, Mouse
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


SCF, Mouse
Description:
SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis.Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules.SCF Protein, Mouse is the recombinant mouse-derived SCF protein, expressed by E.coli , with tag free.Product Name Alternative:
SCF Protein, Mouse, Mouse, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/scf-protein-mouse.htmlPurity:
98.0Smiles:
KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAMolecular Formula:
17311 (Gene_ID) P20826 (K26-A189) (Accession)Molecular Weight:
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
