SCF, Human

CAT:
804-HY-P70781-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SCF, Human - image 1

SCF, Human

  • Description:

    SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human is the recombinant human-derived SCF protein, expressed in E. coli.
  • Product Name Alternative:

    SCF Protein, Human, Human, E. coli
  • UNSPSC:

    12352202
  • Type:

    Recombinant Proteins
  • Assay Protocol:

    https://www.medchemexpress.com/cytokines/scf-protein-human.html
  • Purity:

    98.0
  • Smiles:

    EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
  • Molecular Formula:

    4254 (Gene_ID) P21583-1 (E26-A189) (Accession)
  • Molecular Weight:

    Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations:

    [1]Dehbashi M, Kamali E, Vallian S. Comparative genomics of human stem cell factor (SCF) . Mol Biol Res Commun. 2017;6 (1) :1-11.|[2]Lennartsson J, Rönnstrand L. Stem cell factor receptor/c-Kit: from basic science to clinical implications. Physiol Rev. 2012;92 (4) :1619-1649.|[3]Irani A M, et al. Recombinant human stem cell factor stimulates differentiation of mast cells from dispersed human fetal liver cells[J]. 1992.|[4]Akuta T, et al., Expression of bioactive soluble human stem cell factor (SCF) from recombinant Escherichia coli by coproduction of thioredoxin and efficient purification using arginine in affinity chromatography. Protein Expr Purif. 2015 Jan;105:1-7.
  • Shipping Conditions:

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions:

    Stored at -20°C for 2 years
  • Scientific Category:

    Recombinant Proteins