Mouse Annexin V Recombinant Protein
CAT:
908-RP1685M-01
Size:
1 Vial
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Mouse Annexin V Recombinant Protein
Background:
Annexins are important in various cellular and physiological processes such as providing a membrane scaffold, which is relevant to changes in the physical shape of the cell. Annexin proteins have been shown to be involved in trafficking and organization of vesicles, exocytosis, endocytosis and also calcium ion channel formation. Annexin proteins are not exclusively intracellular protein: Annexin proteins are also found in the extracellular space and have been linked to several processes fibrinolysis, coagulation, inflammation and apoptosis.Description:
The Mouse Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Mouse Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Mouse Annexin V Specifications: (Molecular Weight: 35.8 kDa) (Amino Acid Sequence: MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD (319) ) (Gene ID: 11747) . For research use only.Applications:
Cell Culture, ELISA Standard, ELISpot Control, Western Blot ControlHomology:
Mus musculus (house mouse)Storage Temperature:
-20°C