Swine CCL20 Recombinant Protein
CAT:
908-RP0118S-01
Size:
1 Vial
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Swine CCL20 Recombinant Protein
Background:
CCL20, also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3A) is a small cytokine belonging to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL20/LARC/MIP-3A is strongly chemotactic for lymphocytes. CCL20 elicits its effects on its target cells by binding and activating the chemokine receptor CCR6.Description:
The Swine CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL20 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: ASNFDCCLRYTDHILHPRFIMGFTQQLANEACDINAIIFYTKKKLAVCADPQKIWVKQAVNILSQRVKKM) (Gene ID: 553951) . For research use only.Applications:
Cell Culture, ELISA Standard, ELISpot Control, Western Blot ControlHomology:
Sus scrofa (pig)Storage Temperature:
-20°C
