Swine CCL20 Recombinant Protein

• Background:

  CCL20, also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3A) is a small cytokine belonging to the CC chemokine family. There are at least 27 distinct members of the C-C subgroup reported for mammals. They are characterized by two adjacent cysteines. CC chemokines induce the migration of monocytes and other cell types such as NK cells and dendritic cells. CCL20/LARC/MIP-3A is strongly chemotactic for lymphocytes. CCL20 elicits its effects on its target cells by binding and activating the chemokine receptor CCR6.

• Description:

  The Swine CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL20 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: ASNFDCCLRYTDHILHPRFIMGFTQQLANEACDINAIIFYTKKKLAVCADPQKIWVKQAVNILSQRVKKM) (Gene ID: 553951) . For research use only.

• Applications:

  Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

• Homology:

  Sus scrofa (pig)

• Storage Temperature:

  -20°C