Canine SCF (Stem Cell Factor) Recombinant Protein

• Background:

  SCF (stem cell factor), often known as Kit Ligand, KITL or KITLG, is involved in pathways that control the regulation of cell survival, migration and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, and melanogenesis. The SCF of most vertebrates has a soluble form as well as the membrane bound type I receptor form. Mutations in the SCF pathway may result in a broad range of abnormalities including anemia, and sterility. SCF and KIT interaction has been shown to promote the growth of cancer cells and organoids in culture, and xenograft tumors in mice. SCF is being utilized in many animal model systems, from metastasis research in breast tumor-bearing arthritic mice to the genetic linkage to de-pigmentation in pigs. Interestingly, a second SCF pathway was retained in zebrafish, after a whole genome duplication, and is now undergoing divergent evolution.

• Description:

  The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 403507) . For research use only.

• Applications:

  Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

• Homology:

  Canis lupus dingo (dingo), Canis lupus familiaris (dog)

• Storage Temperature:

  -20°C