Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1)

CAT:
399-CSB-YP861187HU (F)-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1) - image 1

Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1)

  • Product Name Alternative:

    Endogenous prototoxin LYNX1; Testicular tissue protein Li 112
  • Abbreviation:

    Recombinant Human LYNX1 protein
  • Gene Name:

    LYNX1
  • UniProt:

    P0DP58
  • Expression Region:

    21-91aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKVSKSCVPRCFETVYDGYSKHASTTSCCQYDLC
  • Tag:

    N-terminal 6xHis-sumostar-tagged
  • Type:

    Developed Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Relevance:

    Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs) . The proposed role as modulator of nAChR activity seems to be dependent on the nAChR subtype and stoichiometry, and to involve an effect on nAChR trafficking and its cell surface expression, and on single channel properties of the nAChR inserted in the plasma membrane. Modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha-4:beta-2-containing nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha-4:beta-2 nAChRs. Is involved in regulation of the nAChR pentameric assembly in the endoplasmic reticulum. Shifts stoichiometry from high sensitivity alpha-4 (2) :beta-2 (3) to low sensitivity alpha-4 (3) :beta-2 (2) nAChR. In vitro modulates alpha-3:beta-4-containing nAChRs. Reduces cell surface expression of (alpha-3:beta-4) (2) :beta-4 and (alpha-3:beta-4) (2) :alpha-5 nAChRs suggesting an interaction with nAChR alpha-3 (-) : (+) beta-4 subunit interfaces and an allosteric mode. Corresponding single channel effects characterized by decreased unitary conductance, altered burst proportions and enhanced desensitization/inactivation seem to depend on nAChR alpha:alpha subunit interfaces and are greater in (alpha-3:beta-2) (2) :alpha-3 when compared to (alpha-3:beta-2) (2) :alpha-5 nAChRs. Prevents plasticity in the primary visual cortex late in life
  • Endotoxin:

    Not test
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    21.2 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein