Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1), partial

CAT:
399-CSB-YP861187HU2-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1), partial - image 1

Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1), partial

  • Product Name Alternative:

    Secreted LY6/PLAUR domain-containing protein 2 Secreted Ly-6/uPAR-related protein 2
  • Abbreviation:

    Recombinant Human LYNX1 protein, partial
  • Gene Name:

    LYNX1
  • UniProt:

    P0DP58
  • Expression Region:

    57-131aa of P0DP58-2
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Relevance:

    Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3:beta-2-containing nAChRs and strongly these of alpha-4:beta-2-containing nAChRs, modulates alpha-7-containing nAChRs, and inhibits nicotine-induced signaling probably implicating alpha-3:beta-4-containing nAChRs. Proposed to act on alpha-3:beta-2 and alpha-7 nAChRs in an orthosteric, and on mAChRs, such as CHRM1 and CHRM3, in an allosteric manner.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Binds and may modulate the functional properties of nicotinic and muscarinic acetylcholine receptors. May regulate keratinocytes proliferation, differentiation and apoptosis. In vitro moderately inhibits ACh-evoked currents of alpha-3
  • Molecular Weight:

    10 kDa
  • References & Citations:

    "SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris." Tsuji H., Okamoto K., Matsuzaka Y., Iizuka H., Tamiya G., Inoko H. Genomics 81:26-33 (2003)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial