Recombinant Mouse Glutathione-specific gamma-glutamylcyclotransferase 1 (Chac1)

• Product Name Alternative:

  Blocks Notch protein; Cation transport regulator-like protein 1

• Abbreviation:

  Recombinant Mouse Chac1 protein

• Gene Name:

  Chac1

• UniProt:

  Q8R3J5

• Expression Region:

  1-223aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  MKQESASQSTPPPSLSPAPSSAQPSWGDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDREGCTWGVAYQVRGEQVNEALKYLNVREAVLGGYDTKEVTFYPQDTPDQPLTALAYVATPQNPGYLGPAPEEVIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLEAIVDAVGTLLPCSYLPEQPLALT

• Tag:

  C-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Cell Biology

• Relevance:

  Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides. Glutathione depletion is an important factor for apoptosis initiation and execution. Acts as a pro-apoptotic component of the unfolded protein response pathway by mediating the pro-apoptotic effects of the ATF4-ATF3-DDIT3/CHOP cascade. Negative regulator of Notch signaling pathway involved in embryonic neurogenesis: acts by inhibiting Notch cleavage by furin, maintaining Notch in an immature inactive form, thereby promoting neurogenesis in embryos

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  31.5 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length