Recombinant Mouse Glutathione peroxidase 7 (Gpx7) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS958964-03	Recombinant Mouse Glutathione synthetase (Gss)
MBS958964-04	Recombinant Mouse Glutathione synthetase (Gss)
MBS958964-02	Recombinant Mouse Glutathione synthetase (Gss)
MBS958964-05	Recombinant Mouse Glutathione synthetase (Gss)
MBS958964-01	Recombinant Mouse Glutathione synthetase (Gss)
LF-P0425	Glutathione Reductase , Mouse
RPC28390-100ug	Recombinant Mouse Glutathione peroxidase 7 (Gpx7)
MBS964221-01	Recombinant Mouse Glutathione reductase, mitochondrial (Gsr)
MBS964221-04	Recombinant Mouse Glutathione reductase, mitochondrial (Gsr)
MBS1421232-03	Recombinant Mouse Glutathione peroxidase 2 (Gpx2)

Recombinant Mouse Glutathione peroxidase 7 (Gpx7)

CAT:

399-CSB-EP009872MO-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Glutathione peroxidase 7 (Gpx7)

Gene Name: Gpx7
UniProt: Q99LJ6
Expression Region: 19-186aa
Organism: Mus musculus
Target Sequence: QSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLILRKREDL
Tag: N-terminal 10xHis-tagged and C-terminal MYC-tagged
Source: E.coli
Field of Research: Cell Biology
Assay Type: In Stock Protein
Relevance: It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks (By similarity).
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 26.7 kDa
References & Citations: "Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7." Bosello-Travain V., Conrad M., Cozza G., Negro A., Quartesan S., Rossetto M., Roveri A., Toppo S., Ursini F., Zaccarin M., Maiorino M. Biochim. Biophys. Acta 1830:3846-3857 (2013)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Mouse Glutathione peroxidase 7 (Gpx7), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP009872MO-02	Recombinant Mouse Glutathione peroxidase 7 (Gpx7)
CSB-EP009872MO-03	Recombinant Mouse Glutathione peroxidase 7 (Gpx7)
CSB-EP009872MO-01	Recombinant Mouse Glutathione peroxidase 7 (Gpx7)
CSB-EP009989MO-02	Recombinant Mouse Glutathione S-transferase P 1 (Gstp1)
CSB-EP009989MO-01	Recombinant Mouse Glutathione S-transferase P 1 (Gstp1)
CSB-EP009989MO-03	Recombinant Mouse Glutathione S-transferase P 1 (Gstp1)
CSB-EP009982MO-01	Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)
CSB-EP009982MO-02	Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)
CSB-YP009989MO-02	Recombinant Mouse Glutathione S-transferase P 1 (Gstp1)
CSB-EP009982MO-03	Recombinant Mouse Glutathione S-transferase Mu 3 (Gstm3)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on