Recombinant Conus radiatus Iota-conotoxin-like r11c

CAT:
399-CSB-EP770335CPD-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Conus radiatus Iota-conotoxin-like r11c - image 1

Recombinant Conus radiatus Iota-conotoxin-like r11c

  • Product Name Alternative:

    R11.4
  • Abbreviation:

    Recombinant Conus radiatus Iota-conotoxin-like r11c protein
  • UniProt:

    Q7Z096
  • Expression Region:

    37-79aa
  • Organism:

    Conus radiatus (Rayed cone)
  • Target Sequence:

    GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT
  • Tag:

    C-terminal 6xHis-PDI-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Iota-conotoxins bind to voltage-gated sodium channels (Nav) and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. Causes circular motion, convulsions, copious urination, rigid paralysis and death upon intracranial injection into mice. Causes unbalanced swimming, swimming in diagonal and vertical motion and death, when injected intraperitoneally into goldfish. L-Leu and D-Leu forms are active on both nerve and muscle.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    62 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein