Peroxiredoxin 5 (PRDX5) Rabbit pAb (APR30318N)

• Background:

  This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.

• Synonyms:

  PRDX5; ACR1; AOEB166; B166; HEL-S-55; PLP; PMP20; PRDX6; PRXV; SBBI10; prx-V

• Gene ID:

  25824

• UniProt:

  P30044

• Cellular Locus:

  Cytoplasm, Mitochondrion, Peroxisome

• Applications:

  WB (Rana sylvatica)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:20 - 1:50

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 12kDa/17kDa/22kDa Observed MW: 15kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Peroxiredoxin 5 (PRDX5) Rabbit pAb (APR30318N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25824

• Uniprot URL:

  https://www.uniprot.org/uniprot/P30044

• AA Sequence:

  MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL