E2F3 Rabbit pAb (APR28443N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


E2F3 Rabbit pAb (APR28443N)
Background :
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants.Synonyms :
E2F3; E2F-3Gene ID :
1871UniProt :
O00716Cellular Locus :
NucleusApplications :
WB (Mus musculus)Dilution :
WB 1:500 - 1:2000Form :
LiquidBuffer :
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight :
Calculated MW: 37kDa/49kDa Observed MW: 53kDaStorage Conditions :
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview :
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality E2F3 Rabbit pAb (APR28443N) .Gene ID URL :
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1871Uniprot URL :
https://www.uniprot.org/uniprot/O00716AA Sequence :
SIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ

