NLGN4X Rabbit pAb (APR27872N)

• Background:

  This gene encodes a member of the type-B carboxylesterase/lipase protein family. The encoded protein belongs to a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs large homolog 4 (DLG4) . Mutations in this gene have been associated with autism and Asperger syndrome. Alternative splicing results in multiple transcript variants.

• Synonyms:

  NLGN4X; ASPGX2; AUTSX2; HLNX; HNL4X; NLGN4; neuroligin-4; X-linked

• Gene ID:

  57502

• UniProt:

  Q8N0W4

• Cellular Locus:

  Cell junction, Cell membrane, Single-pass type I membrane protein, postsynaptic cell membrane, postsynaptic density, synapse

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 91kDa/94kDa Observed MW: 92kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NLGN4X Rabbit pAb (APR27872N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57502

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q8N0W4

• AA Sequence:

  YYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV