[KO Validated] KDM5B Rabbit pAb (APR27686N)

CAT:
882-APR27686N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
[KO Validated] KDM5B Rabbit pAb (APR27686N) - image 1

[KO Validated] KDM5B Rabbit pAb (APR27686N)

  • Background:

    This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants.
  • Synonyms:

    KDM5B; CT31; JARID1B; PLU-1; PLU1; PPP1R98; PUT1; RBBP2H1A; RBP2-H1
  • Gene ID:

    10765
  • UniProt:

    Q9UGL1
  • Cellular Locus:

    Nucleus
  • Applications:

    WB (Human hepatocellular carcinoma cell line)
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 175kDa/179kDa Observed MW: 176KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] KDM5B Rabbit pAb (APR27686N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10765
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q9UGL1
  • AA Sequence:

    EESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEE