[KO Validated] RhoGDI Rabbit pAb (APR18819N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] RhoGDI Rabbit pAb (APR18819N) - image 1](/gentaur-product-1.webp)
![[KO Validated] RhoGDI Rabbit pAb (APR18819N) - image 1](/gentaur-product-1.webp)
[KO Validated] RhoGDI Rabbit pAb (APR18819N)
Background:
This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants.Synonyms:
ARHGDIA; GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1Gene ID:
396UniProt:
P52565Cellular Locus:
CytoplasmApplications:
WB (Homo sapiens, Rattus norvegicus, Mus musculus)Dilution:
WB 1:500 - 1:2000 IF 1:50 - 1:200Form:
LiquidBuffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight:
Calculated MW: 18kDa/23kDa Observed MW: 25kDaStorage Conditions:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview:
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] RhoGDI Rabbit pAb (APR18819N) .Gene ID URL:
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=396Uniprot URL:
https://www.uniprot.org/uniprot/P52565AA Sequence:
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
