KRT6B Rabbit pAb (APR27615N)

CAT: 0882-APR27615N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR27615N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. Mutations in these genes have been associated with pachyonychia congenita. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KRT6B Rabbit pAb (APR27615N) .

Synonyms

KRT6B; CK-6B; CK6B; K6B; KRTL1; PC2; PC4

Gene ID

3854

UniProt

P04259

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3854

Uniprot URL

https://www.uniprot.org/uniprot/P04259

AA Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMN

UniProtKB · P04259

Keratin, type II cytoskeletal 6B

K2C6B_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P04259
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: KRT6B
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: P48669

Protein keywords

PTM

Acetylation

Domain

Coiled coil

Technical term

Direct protein sequencingProteomics identificationReference proteome

Disease

Disease variantEctodermal dysplasiaPalmoplantar keratoderma

Cellular component

Intermediate filamentKeratin

Related Products

Catalog	Name
APR28615N-01	ADAM28 Rabbit pAb (APR28615N)
APR26715N-01	LGALS2 Rabbit pAb (APR26715N)
APR25615N-01	EIF5A2 Rabbit pAb (APR25615N)
APR20615N-01	RPA3 Rabbit pAb (APR20615N)
APR27815N-01	PLOD1 Rabbit pAb (APR27815N)
APR27651N-01	SULT2B1 Rabbit pAb (APR27651N)
APR27625N-01	PFKL Rabbit pAb (APR27625N)
APR27612N-01	INPP4A Rabbit pAb (APR27612N)
APR27611N-01	IL5 Rabbit pAb (APR27611N)
APR27915N-01	AMY2A Rabbit pAb (APR27915N)

Alternative Products

Catalog	Name
A7696	KRT6B Rabbit pAb
GTR18034764-01	KRT6B Rabbit Polyclonal Antibody
PA15938-01	Rabbit Anti-Human KRT6B pAb
TA322591	Anti-KRT6B Rabbit Polyclonal Antibody
E10G10756	KRT6A/KRT6B/KRT6C Rabbit Polyclonal Antibody
PAV1950	Rabbit Anti-K2C6B/KRT6B Polyclonal Antibody
TA362052	Cytokeratin 6B (KRT6B) Rabbit Polyclonal Antibody
566766-01	KRT6B
CSB-PA289802	KRT6B Antibody