ITLN1 Rabbit pAb (APR27226N)

• Background:

  Intelectin-1 (ITLN1) is a secreted protein and contains 1 fibrinogen C-terminal domain. Intelectin-1 is a 40 kDaCa-dependent galactofuranose-binding lectin that is not a C-type lectin. It is expressed on multiple cell typesand appears to participate in insulin signaling and microbe recognition. The protein has no effect on basalglucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. It increases AKT phosphorylationin the absence and presence of insulin and it may play a role in the defense systemagainst microorganisms. Italso may specifically recognize carbohydrate chains of pathogens and bacterial components containinggalactofuranosy l residues, in a calcium-dependent manner.

• Synonyms:

  ITLN1; HL-1; HL1; INTL; ITLN; LFR; hIntL; omentin

• Gene ID:

  55600

• UniProt:

  Q8WWA0

• Cellular Locus:

  Cell membrane, GPI-anchor, Lipid-anchor, Secreted

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 34kDa Observed MW: 37kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ITLN1 Rabbit pAb (APR27226N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55600

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q8WWA0

• AA Sequence:

  TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR