NMDAR1 Rabbit pAb (APR27166N)

CAT:
882-APR27166N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
NMDAR1 Rabbit pAb (APR27166N) - image 1

NMDAR1 Rabbit pAb (APR27166N)

  • Background:

    The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
  • Synonyms:

    GRIN1; GluN1; MRD8; NMD-R1; NMDA1; NMDAR1; NR1; NMDA 1
  • Gene ID:

    2902
  • UniProt:

    Q05586
  • Cellular Locus:

    Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, postsynaptic density, synapse
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:200
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 99kDa/101kDa/103kDa/105kDa/106kDa/107kDa Observed MW: 105kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NMDAR1 Rabbit pAb (APR27166N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2902
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q05586
  • AA Sequence:

    ALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELS