RLN2 Rabbit pAb (APR26982N)

CAT: 0882-APR26982N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR26982N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a member of the relaxin subfamily and insulin superfamily of peptide hormones. In humans there are three non-allelic relaxin genes. This gene encodes multiple protein isoforms, at least one of which undergoes proteolytic processing. This processing generates relaxin A and B chains that are linked by disulfide bonds to form the mature peptide hormone. This hormone plays a role in the male and female reproductive systems and was initially noted for its role in pregnancy. This protein also plays broader roles in the cardiovascular system, including in the regulation of blood pressure and control of heart rate, and data from animal models shows that this protein may have anti-fibrotic and cardioprotective effects.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RLN2 Rabbit pAb (APR26982N) .

Synonyms

RLN2; H2; H2-RLX; RLXH2; bA12D24.1.1; bA12D24.1.2; relaxin 2

Gene ID

6019

UniProt

P04090

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/21kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6019

Uniprot URL

https://www.uniprot.org/uniprot/P04090

AA Sequence

DSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC

UniProtKB · P04090

Prorelaxin H2

REL2_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P04090
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: RLN2
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A0AVM0, Q99936, Q9UCX3, Q9UQJ2

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

PTM

Cleavage on pair of basic residuesDisulfide bondPyrrolidone carboxylic acid

Molecular function

Hormone

Cellular component

Secreted

Domain

Signal

Related Products

Catalog	Name
APR27982N-01	MGAT3 Rabbit pAb (APR27982N)
APR26984N-01	RORA Rabbit pAb (APR26984N)
APR26892N-01	ASGR1 Rabbit pAb (APR26892N)
APR26582N-01	FLCN Rabbit pAb (APR26582N)
APR26482N-01	MLN Rabbit pAb (APR26482N)
APR26282N-01	KCNN3 Rabbit pAb (APR26282N)
APR24982N-01	CDC37 Rabbit pAb (APR24982N)
APR29682N-01	TAS1R2 Rabbit pAb (APR29682N)
APR20982N-01	GPR128 Rabbit pAb (APR20982N)
APR28982N-01	MYOM2 Rabbit pAb (APR28982N)

Alternative Products

Catalog	Name
E45R26982N	RLN2 Rabbit pAb
AP31596SU-N	RLN2 Rabbit Polyclonal Antibody
PA15284-01	Rabbit Anti-Human RLN2 pAb
TA360212	Relaxin 2 (RLN2) Rabbit Polyclonal Antibody
PAV3316	Rabbit Anti-REL2/RLN2 Polyclonal Antibody
E56PA0207	Relaxin 2/RLN2 Rabbit Monoclonal Antibody (Capture)
E56PA0206	Relaxin 2/RLN2 Rabbit Monoclonal Antibody (Detector)
AP33329SU-N	Relaxin 2 (RLN2) (1-8) Rabbit Polyclonal Antibody
AP02200SU-N	Relaxin 2 (RLN2) (175-185) Rabbit Polyclonal Antibody
AA-41-01	RLN2