Argonaute-2 Rabbit pAb (APR26859N)

• Background:

  This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

• Synonyms:

  AGO2; CASC7; EIF2C2; LINC00980; PPD; Q10; protein argonaute-2; Argonaute 2; EIF2C2

• Gene ID:

  27161

• UniProt:

  Q9UKV8

• Cellular Locus:

  Cytoplasm, Nucleus, P-body

• Applications:

  IP (Homo sapiens) WB (Homo sapiens)

• Dilution:

  WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 93kDa/97kDa Observed MW: 110kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Argonaute-2 Rabbit pAb (APR26859N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=27161

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9UKV8

• AA Sequence:

  MDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVEL