ATP6AP2 Rabbit pAb (APR26608N)

CAT:
882-APR26608N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ATP6AP2 Rabbit pAb (APR26608N) - image 1

ATP6AP2 Rabbit pAb (APR26608N)

  • Background:

    This gene encodes a protein that is associated with adenosine triphosphatases (ATPases) . Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.
  • Synonyms:

    ATP6AP2; APT6M8-9; ATP6IP2; ATP6M8-9; ELDF10; HT028; M8-9; MRXE; MRXSH; MSTP009; PRR; RENR; XMRE; XPDS
  • Gene ID:

    10159
  • UniProt:

    O75787
  • Cellular Locus:

    Membrane, Single-pass type I membrane protein
  • Dilution:

    WB 1:500 - 1:2000 IF 1:50 - 1:100
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 35kDa/39kDa Observed MW: 48kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATP6AP2 Rabbit pAb (APR26608N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10159
  • Uniprot URL:

    https://www.uniprot.org/uniprot/O75787
  • AA Sequence:

    MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD